DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT1E1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_005411.1 Gene:SULT1E1 / 6783 HGNCID:11377 Length:294 Species:Homo sapiens


Alignment Length:278 Identity:85/278 - (30%)
Similarity:145/278 - (52%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLE------FNGV 116
            |.|..|:.|.||:.|.|.||.||||:.|:.:::..|.|.|..|...:.:|.||||      .|||
Human    28 DNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGV 92

  Fly   117 VPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGY 181
                     ...:.:.|||::|:|||..:||...|.|..||||:.||.||.|:|:::.:..:.|:
Human    93 ---------KQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGH 148

  Fly   182 --QGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERS 244
              .|:..:|:..|:.|.|.:...:.|:..:|:....|.:.|..||.:|..:.:.:.::..||||.
Human   149 PNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERK 213

  Fly   245 VSQEQMQQMQRHLSFESMRDNPACNHV---KEFESMKAAAGREVEEFRFVRRGVVGSHKDELTAD 306
            .|:|.:.::..|.||:.|::||:.|:.   .|..:.|.:.        |:|:|:.|..|:..|..
Human   214 PSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSP--------FMRKGITGDWKNHFTVA 270

  Fly   307 IIREFDLWSDSNLRDFKL 324
            :..:||...:..:::..|
Human   271 LNEKFDKHYEQQMKESTL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 80/265 (30%)
SULT1E1NP_005411.1 Sulfotransfer_1 37..287 CDD:395556 80/266 (30%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P49891 105..107 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4327
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8574
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5797
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.