DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2a3

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001095056.2 Gene:Sult2a3 / 629203 MGIID:3645873 Length:285 Species:Mus musculus


Alignment Length:267 Identity:68/267 - (25%)
Similarity:124/267 - (46%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFN-GVVPNVPHDTIA 126
            |.|:::|:.|:|.||.||.|:.|:..|:....|.:..::|.:..|||:||.: |.:..:..:   
Mouse    30 FVVKEEDLLILTYPKSGTHWLIEIVCLIQTRGDPKWIQTVPIWDRSPWLETDIGYLALINKE--- 91

  Fly   127 AANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAIS--YFHHWRGMVGYQGTKSDFM 189
                  .||||.||||..:..:..:|.:.|.||:.|||:|..:|  :|:....:|...|:...:.
Mouse    92 ------GPRLISSHLPVHLFFKSFFSSKAKAIYLIRNPRDILVSGYFFYGNTNLVKNPGSLRTYF 150

  Fly   190 HSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQ 254
            ..|:.|.|.:...:.|:..:..:|...|.....||.||......|.::..||.:.:..:::..:.
Mouse   151 EWFLKGNVIYGSWFEHVRGWLSMREWDNFLVLYYEDMKKDTKGTIKKICDFLGKKLEPDELDLVL 215

  Fly   255 RHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNL 319
            ::.||::|::|...|:....|.|      .....:.:|:|..|..|:..|......|:......:
Mouse   216 KYSSFQAMKENNMSNYSLVSEDM------ITNGLKLMRKGTTGDWKNHFTVAQAEAFNKVFQEKM 274

  Fly   320 RDFKLNM 326
            ..|...|
Mouse   275 AGFPQGM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 64/257 (25%)
Sult2a3NP_001095056.2 Sulfotransfer_1 34..278 CDD:279075 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.