DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult3st4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001295759.1 Gene:sult3st4 / 619243 ZFINID:ZDB-GENE-050913-17 Length:299 Species:Danio rerio


Alignment Length:321 Identity:89/321 - (27%)
Similarity:150/321 - (46%) Gaps:52/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DKLAISGGYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTT 81
            |||.   .|.....:.:||..:...:              :|.:.|||.|||||::||.||.||.
Zfish    11 DKLL---KYKETVLTLEPSYDITPEY--------------IDSIQDFETRDDDVFVVTFPKSGTV 58

  Fly    82 WMQELAWLVINECDF-ETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWM 145
            |.|.:..|:..| || |.||.:.. .:.|::|:.....:.        :..|||||..|||...:
Zfish    59 WTQRIITLIYEE-DFPEKAKQITF-EQMPWIEYRKKGKDY--------STRPSPRLFCSHLLEPL 113

  Fly   146 LPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKS--DFMHSFIDGYVNFTPCWPHILD 208
            :|:.: .::.|:|||.|||||..:||||..:.|......||  :.:.:|:.|.:.....:.|:..
Zfish   114 MPKTL-KRKGKVIYVMRNPKDVMVSYFHFSKKMKNLDSAKSYDEVLENFLTGCMVGGSWFDHVKG 177

  Fly   209 FWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKE 273
            :...:.:.||...:||.|...|..||.::.:|:.:::|...:.::....:|:.|:.:|..|    
Zfish   178 WVTSKDKYNILILTYEEMIKDLRSVIVKICEFVGKNLSDAAIDKVVERATFKQMKVDPVAN---- 238

  Fly   274 FESM--------KAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRDFKLNM 326
            :||:        |.|         |:|:|.||..::.||.......|...:..::|..||:
Zfish   239 YESLPVDITDQPKGA---------FMRKGTVGDWRNSLTMAQSECVDGALEERMKDVPLNL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 75/265 (28%)
sult3st4NP_001295759.1 Sulfotransfer_1 44..287 CDD:279075 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593158
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4488
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.