DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult4a1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_113829.1 Gene:Sult4a1 / 58953 RGDID:69292 Length:284 Species:Rattus norvegicus


Alignment Length:287 Identity:89/287 - (31%)
Similarity:139/287 - (48%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSVPVVGNWEQRF-----CRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINE 93
            |..|  |.:|.::     .||....:..::.:.||.||..||||||.||.||:.:||:.:||...
  Rat     9 PGTP--GEFESKYFEFHGVRLPPFCRGKMEDIADFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQG 71

  Fly    94 CDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKII 158
            .|.:....:::..:.|.||:       |...:.....|.||||||||||...||..:.:...|:|
  Rat    72 ADPDEIGLMNIDEQLPVLEY-------PQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVI 129

  Fly   159 YVYRNPKDAAISYFHHWRGM--VGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFT 221
            |:.|||||..:||:...|.:  :.|:||..:|...|::..:.:...:.|:.:||:.|.:.|:.|.
  Rat   130 YMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDANVLFL 194

  Fly   222 SYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVE 286
            .||.|...|..::.::|:||..|..:.|::.:..|.  ..:.|. .||                .
  Rat   195 KYEDMHRDLVTMVEQLARFLGVSCDKAQLESLIEHC--HQLVDQ-CCN----------------A 240

  Fly   287 EFRFVRRGVVGSHKDELTADIIREFDL 313
            |...|.||.||..||..|..:..:|||
  Rat   241 EALPVGRGRVGLWKDIFTVSMNEKFDL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/249 (32%)
Sult4a1NP_113829.1 Sulfotransfer_1 45..277 CDD:395556 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.