DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult3a1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_065590.2 Gene:Sult3a1 / 57430 MGIID:1931469 Length:293 Species:Mus musculus


Alignment Length:273 Identity:96/273 - (35%)
Similarity:154/273 - (56%) Gaps:17/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNV 120
            |::.:.::|:||||::|||.||.||.|.|::..|:..|......::::...|:||.|:|      
Mouse    25 VVENIENYEIRDDDIFIVTYPKSGTIWTQQILSLIYFEGHRNRTENIETIDRAPFFEYN------ 83

  Fly   121 PHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQG-- 183
            .|....|  .:||||:..||:|.:::|:.:..|:.||:|:||||||..|||||....|:.:|.  
Mouse    84 IHKLDYA--KMPSPRIFSSHIPYYLVPKGLKDKKAKILYIYRNPKDVLISYFHFSNLMLIFQNPD 146

  Fly   184 TKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQE 248
            |...||.:|:||.|..:..:.||..:::.||:.||.|.|:|.||..|...:.::..|||:.:|:|
Mouse   147 TVESFMQTFLDGDVVGSLWFDHIRGWYEHRHDFNIMFMSFEDMKKDLRSSVLKICSFLEKELSEE 211

  Fly   249 QMQQMQRHLSFESMRDNPACN--HVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREF 311
            .:..:.|..:|:.|:.:|..|  |:     :|...|...|...|:|:||||..|..||.|....|
Mouse   212 DVDAVVRQATFQKMKADPRANYEHI-----IKDELGTRNEMGSFLRKGVVGDWKHYLTVDQSERF 271

  Fly   312 DLWSDSNLRDFKL 324
            |.....|:::..|
Mouse   272 DKIFHRNMKNIPL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 92/258 (36%)
Sult3a1NP_065590.2 Sulfotransfer_1 36..280 CDD:366246 92/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847774
Domainoid 1 1.000 159 1.000 Domainoid score I4072
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5797
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.