DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult5a1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_065589.2 Gene:Sult5a1 / 57429 MGIID:1931463 Length:291 Species:Mus musculus


Alignment Length:264 Identity:71/264 - (26%)
Similarity:130/264 - (49%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAA 127
            |:.:|.|:.:||.||.||||||::..|:..|.......::....|.|::|      .:..|::.:
Mouse    32 FQFQDTDILLVTFPKSGTTWMQQVLSLIFCEGHLWPIHNLPTWARVPWIE------QISFDSLHS 90

  Fly   128 ANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR--GMVGYQGTKSDFMH 190
            ......|||..|||.|..|...:...:.|::|:.|||||..:|:||..|  |.:....:..||:.
Mouse    91 KRNTSWPRLFTSHLNAKGLSPALMKSKAKVVYMARNPKDVLVSFFHFHRIAGFLPNPSSFEDFVD 155

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            .|::|...|...:.|:..:..|:.:..:||.:||.:..:....|.::::||.|.:..::...:..
Mouse   156 EFLEGTGFFGSWFDHVKGWLSLQKDLTLFFVTYEELHQEPRSTIRKLSEFLGRPLGPKEEDIILE 220

  Fly   256 HLSFESMRDNPACNHVKEFESMKAAAGREV---EEFRFVRRGVVGSHKDELTADIIREFDLWSDS 317
            |.||..|..:...|:        :...:|:   .|.:|.|:||||:.::..|.::..:|:....|
Mouse   221 HSSFSFMSQSNIVNY--------SLLSKEIIDQSEGKFFRKGVVGNWREYFTPELNEKFNAVYQS 277

  Fly   318 NLRD 321
            .:.|
Mouse   278 KMGD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/260 (27%)
Sult5a1NP_065589.2 Sulfotransfer_1 36..283 CDD:366246 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.