DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001343872.1 Gene:Sult1b1 / 56362 MGIID:2136282 Length:299 Species:Mus musculus


Alignment Length:291 Identity:87/291 - (29%)
Similarity:148/291 - (50%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAW 88
            ||..|:|.:.       |||               |:.:|:....|:.|.|.||.||||:.|:..
Mouse    17 GYPMIYAFAL-------NWE---------------RIEEFQSTPGDIVITTYPKSGTTWLSEIVD 59

  Fly    89 LVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSK 153
            :|:|:.:.|..|...:|.:.|.||.:  ||.:....:......||||:||:|||..:||:..|..
Mouse    60 MVLNDGNVEKCKRDVITSKVPMLELS--VPGIRISGVELLKKTPSPRIIKTHLPIDLLPKSFWEN 122

  Fly   154 RPKIIYVYRNPKDAAISYFHH--WRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEP 216
            :.|:||:.||.||.|:||:|.  ...:....||..:::..|:.|.|.:...:.|:..:|:.|.|.
Mouse   123 KCKMIYLARNGKDVAVSYYHFDLMNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEH 187

  Fly   217 NIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAA 281
            .:.:..||.:|....:.|.::|.||::::.:|.:.::..|.|||.|::||..|:     :....|
Mouse   188 PLLYLYYEELKQNPKKEIKKIASFLDKTLDEEALDRIVHHTSFEMMKENPLVNY-----THLPTA 247

  Fly   282 GREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            ..:..:..|:|:|:||..|:..|.....:||
Mouse   248 MMDHSKSPFMRKGIVGDWKNYFTMTQTEQFD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 78/248 (31%)
Sult1b1NP_001343872.1 Sulfotransfer_1 38..289 CDD:395556 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69169
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.