DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001347713.1 Gene:Sult2b1 / 54200 MGIID:1926342 Length:372 Species:Mus musculus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:134/252 - (53%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAAN 129
            |||||::|||.||.||.||.|:..|::.:.|....:|..:..|:|:.|          ..|:|.|
Mouse    89 VRDDDIFIVTYPKSGTNWMIEIVCLILKDGDPSWIRSEPIWQRAPWCE----------TIISAFN 143

  Fly   130 AL--PSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR--GMVGYQGTKSDFMH 190
            .|  ||||::.||||..:..:..:|.:.|:|||.|||:|..:|.:::.:  |.:...||...|:.
Mouse   144 VLDRPSPRIMSSHLPIELFTKAFFSSKAKVIYVGRNPRDVVVSLYYYSKIAGQLKDPGTPDQFLQ 208

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            :|:.|.|.|...:.||..:.:::::.|..|.:||.::..|...:..:.:||.|.:.:|.:..:..
Mouse   209 NFLKGEVQFGSWFDHIKGWIRMQNQENFLFITYEELQQDLRGSVQRICEFLGRPLGEEALSSVVA 273

  Fly   256 HLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            |.:|.:|:.|...|:     |:..|:..:..:..|:|:|:.|..|:..|......||
Mouse   274 HSAFAAMKANTMSNY-----SLLPASLLDHRQGEFLRKGISGDWKNHFTVAQSEAFD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 75/250 (30%)
Sult2b1NP_001347713.1 Sulfotransfer_1 91..334 CDD:366246 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.