DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult6b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001178946.1 Gene:Sult6b1 / 503103 RGDID:1598187 Length:303 Species:Rattus norvegicus


Alignment Length:273 Identity:79/273 - (28%)
Similarity:127/273 - (46%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFL 111
            |.| :||: .||.   ||.|.||:.:.:.||||:.|:..    :::|..|..:|........|.|
  Rat    40 CTL-ETFR-ALDA---FEARSDDILLASYPKCGSNWILH----IVSELIFAVSKKKYACPEFPVL 95

  Fly   112 EFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR 176
            |....      :.......|||||::.:||....||:.::..:.||:.::|||||.|:|:||...
  Rat    96 ECGDA------EKYQRMKRLPSPRILTTHLHCDKLPQSVFKSKAKILVMFRNPKDTAVSFFHFHN 154

  Fly   177 GM--VGYQGTKSDFMHSFIDGYVNFTPCWPHILDF---WQLRH--EPNIFFTSYERMKGQLGQVI 234
            .:  :....:..:|...||.|.|:    |....||   |. :|  |.|:.|..||.:|..|...|
  Rat   155 DVPDIPSYASWDEFFRQFIKGQVS----WGSYFDFAINWN-KHIDEENVKFILYEDLKENLVVGI 214

  Fly   235 SEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSH 299
            .::::||..|::..|::.:....:|::||       .|..|:..|     :..|.| |:|.||..
  Rat   215 KQISEFLGFSLTDAQIKTISAQSTFQAMR-------AKSQETHGA-----IGPFLF-RKGEVGDW 266

  Fly   300 KDELTADIIREFD 312
            |........:|.|
  Rat   267 KSLFNETQNQEMD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/253 (28%)
Sult6b1NP_001178946.1 Sulfotransfer_1 56..288 CDD:279075 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.