DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and RGD1559960

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038940339.1 Gene:RGD1559960 / 501084 RGDID:1559960 Length:296 Species:Rattus norvegicus


Alignment Length:279 Identity:86/279 - (30%)
Similarity:145/279 - (51%) Gaps:27/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKS 101
            |.|.|     ||          ::..|..:.||.:|.|.||.||.|:||:..::....|.:..:.
  Rat    24 PTVDN-----CR----------QIQMFNTKPDDFFICTYPKSGTKWIQEIVDMIDQNGDIKKCQR 73

  Fly   102 VDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKD 166
            ....||.|::|:  ..|..| ..:..|||:|:||::::|||..:||...|:...|.:||.||.||
  Rat    74 AINQHRPPYIEW--ARPPQP-SGVDKANAMPAPRILRTHLPTQLLPPSFWTNNCKYLYVARNAKD 135

  Fly   167 AAISYFHHWR--GMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQ 229
            ..:||:|.:|  .::...||.:::..:||:|.|::...:.|:..:|::|....|.|..||.||..
  Rat   136 CMVSYYHFYRMSQVLPNPGTWNEYFETFINGKVSWGSWFDHVKGWWEIRDRYQILFLFYEDMKRD 200

  Fly   230 LGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESM-KAAAGREVEEFRFVRR 293
            ..:.|.:|.||:.:::.:|.:.::....|||.|:|||..|    |.:: |....:.:..  |:|:
  Rat   201 PKREIQKVMQFMGKNLDEETVDKIVLETSFEKMKDNPLTN----FSTIPKTIMDQSISP--FMRK 259

  Fly   294 GVVGSHKDELTADIIREFD 312
            |:||..|:..|......||
  Rat   260 GIVGDWKNHFTVAQNERFD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 80/249 (32%)
RGD1559960XP_038940339.1 Sulfotransfer_1 39..288 CDD:395556 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351365
Domainoid 1 1.000 153 1.000 Domainoid score I4182
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.