DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and XB5897337

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011496.1 Gene:XB5897337 / 496998 XenbaseID:XB-GENE-5897338 Length:297 Species:Xenopus tropicalis


Alignment Length:274 Identity:81/274 - (29%)
Similarity:146/274 - (53%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVP 121
            :|.:.||:|:|.||::||.||.||.|.|::..|:.||......:::....|.|::|:..  ..|.
 Frog    31 IDSIQDFKVKDTDVFLVTYPKTGTIWTQQILSLIFNEGHRNGTEAIANVFRVPWIEYTH--SKVD 93

  Fly   122 HDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTK- 185
            :|      :.|||||..||||.:::|:.:.:|:.|||||.|||||||:||:|.:..:|..:... 
 Frog    94 YD------SRPSPRLFSSHLPHYLVPKDLRNKKGKIIYVGRNPKDAAVSYYHFYNVIVRLKQVND 152

  Fly   186 -SDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQ 249
             ..|:..::.|.|.....:.|:..::..:.:.||.|.:||.||..|...:.::.:|:|:.:::::
 Frog   153 WESFLDRYLTGEVLGGSWFDHVKGWYTHQEDFNILFVTYEEMKKDLRSAVLKICKFVEKELNEQE 217

  Fly   250 MQQMQRHLSFESMRDNPACNHVK---EFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREF 311
            :..:....:|::|:.:|..|:..   :...||...        |:|||.||..|..:|.....:|
 Frog   218 VDTIVEKATFKNMKHDPLANYTNVSTDHLDMKNGT--------FLRRGTVGDWKKLMTVAQNEKF 274

  Fly   312 DLWSDSNLRDFKLN 325
            |......::...:|
 Frog   275 DKIYSEKMKGVPIN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 76/259 (29%)
XB5897337NP_001011496.1 Sulfotransfer_1 41..286 CDD:395556 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5797
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.