DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult1c4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031746282.1 Gene:sult1c4 / 496982 XenbaseID:XB-GENE-6048086 Length:585 Species:Xenopus tropicalis


Alignment Length:269 Identity:84/269 - (31%)
Similarity:140/269 - (52%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSV 102
            :..||:|               :..|:.|..||.|.|.||.||||:||:..|::||.:.|..:..
 Frog   315 IASNWQQ---------------IQSFQARPGDVLIATYPKAGTTWVQEIVDLILNEGNEEICRRS 364

  Fly   103 DLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDA 167
            ....|.||:|...::...|.:    .||:||||::|:|||..::|...|..:.|:|||.|||:|.
 Frog   365 PTHERMPFVEVLHMMKPGPEE----VNAMPSPRVLKTHLPVQLVPPLFWRYKCKVIYVARNPRDT 425

  Fly   168 AIS--YFHHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQL 230
            ..|  ||.|........|:..:::|.|:.|.|.:...:.|:..||:.:.:.||.:..||.:|...
 Frog   426 VTSYYYFDHTITFHPAPGSWEEYLHRFMKGDVGWGSWYDHVKGFWEQKDQHNILYLFYEDIKQNP 490

  Fly   231 GQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGV 295
            ...|.:|.:||::.:|:|.::::....||:.|:|||..|    |.:..:.. .:..:::|:|:|.
 Frog   491 IHEIRKVMRFLDKDLSEEVLEKIVHLSSFDHMKDNPMAN----FSAFPSDV-VDQSQYKFMRKGK 550

  Fly   296 VGSHKDELT 304
            ||..|...|
 Frog   551 VGDWKSHFT 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/240 (33%)
sult1c4XP_031746282.1 Sulfotransfer_1 31..280 CDD:395556
Sulfotransfer_1 329..577 CDD:395556 79/240 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.