DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT1A4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017390.1 Gene:SULT1A4 / 445329 HGNCID:30004 Length:295 Species:Homo sapiens


Alignment Length:285 Identity:88/285 - (30%)
Similarity:138/285 - (48%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LADTFQPVLDRV----------------YDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFE 97
            :.||.:|.|:.|                ..|:.|.||:.|.|.||.||||:.::..::....|.|
Human     4 IQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLE 68

  Fly    98 TAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYR 162
            ......:..|.||||.|.  |..| ..:......|.|||||||||..:||:.:..::.|::||.|
Human    69 KCNRAPIYVRVPFLEVND--PGEP-SGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVAR 130

  Fly   163 NPKDAAISYFHHWRGMVGY--QGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYER 225
            ||||.|:||:|..|....:  .||...|:..|:.|.|::...:.|:.::|:|.....:.:..||.
Human   131 NPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYED 195

  Fly   226 MKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFR- 289
            ||....:.|.::.:|:.||:.:|.|..|.:|.||:.|:.||..|:        ....:|:.:.. 
Human   196 MKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY--------TTVPQELMDHSI 252

  Fly   290 --FVRRGVVGSHKDELTADIIREFD 312
              |:|:|:.|..|...|......||
Human   253 SPFMRKGMAGDWKTTFTVAQNERFD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 81/251 (32%)
SULT1A4NP_001017390.1 Sulfotransfer_1 38..287 CDD:395556 81/251 (32%)
Substrate binding 106..108 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157372
Domainoid 1 1.000 149 1.000 Domainoid score I4409
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4327
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8574
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.