DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult1st6

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001002599.1 Gene:sult1st6 / 436872 ZFINID:ZDB-GENE-040718-343 Length:308 Species:Danio rerio


Alignment Length:329 Identity:92/329 - (27%)
Similarity:145/329 - (44%) Gaps:70/329 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NWEQRFCRLADTFQ----------PVLDRVYD-------FEVRDDDVWIVTLPKCGTTWMQELAW 88
            ::|:...|.||..|          |::..:.|       |.....|:.|.|.||.||||.||:..
Zfish     7 SYEEAITRAADAIQRFPLKDVQGVPLMSTIADNWKSISEFCPDPSDLLISTYPKAGTTWTQEIVD 71

  Fly    89 LVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPS----------PRLIKSHLPA 143
            |::|..|.:..|......|.||||            |.|...:||          ||:||:|||.
Zfish    72 LLLNNGDAQVCKRAPTAVRIPFLE------------ICAPPPIPSGLELLKQMKPPRVIKTHLPI 124

  Fly   144 WMLPRQIWSKRPKIIYVYRNPKDAAISYFHH------------WRGMVGYQGTKSDFMHSFIDGY 196
            .::|...|..:.|:||:.||.||..:||||.            |.|          ::|.|:.|.
Zfish   125 QLVPVGFWQNKCKVIYMARNAKDNLVSYFHFDRMNLTQPEPGPWDG----------YIHKFMKGQ 179

  Fly   197 VNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFES 261
            :.:...:.|:..:|:...|.||.:..||.||....:.|..:..:|:.|||::.:.::.:..||..
Zfish   180 LGWGSWYDHVKGYWKESKERNILYILYEDMKENPSREIKRIMHYLDLSVSEDVINKIVQLTSFHV 244

  Fly   262 MRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRD----F 322
            |:|||..|:   ....||...:.:.  .|:|:|.||...:..|....:.||....:.::|    |
Zfish   245 MKDNPMANY---SYIPKAVFDQSIS--AFMRKGEVGDWVNHFTPAQSKMFDEDYTNQMKDVDIPF 304

  Fly   323 KLNM 326
            :||:
Zfish   305 RLNI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 81/280 (29%)
sult1st6NP_001002599.1 Sulfotransfer_1 50..299 CDD:279075 80/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593191
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4488
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.