DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2a4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001095004.1 Gene:Sult2a4 / 434121 MGIID:3645854 Length:284 Species:Mus musculus


Alignment Length:252 Identity:70/252 - (27%)
Similarity:121/252 - (48%) Gaps:16/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAA 127
            |.|:::|:.|:|.||.||.|:.|:..|:..:.|.:..::|.:..|||:||.|...|       |.
Mouse    29 FVVKEEDLLILTYPKSGTNWLIEIVCLIQTKGDSKWIQTVSIQDRSPWLETNRGYP-------AL 86

  Fly   128 ANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHW--RGMVGYQGTKSDFMH 190
            .|. ..||||.||||..:..:..:|.:.|.||:.|||:|..:|.:..|  ..:|...|:...:..
Mouse    87 INK-QGPRLITSHLPIHLFSKSFFSSKAKAIYLIRNPRDILLSGYFFWGNTNLVKNPGSLRTYFE 150

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            .|:.|.|.:...:.|:..:..:|...|.....||.||......|.::..||.:.:..:::..:.:
Mouse   151 WFLKGNVIYGSWFEHVCGWLSMREWDNFLVLYYEDMKKDTKGTIKKICDFLGKKLEPDELDLVLK 215

  Fly   256 HLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            :.||::|::|...|:....|.:      ....|:.:|:|..|..|:..|......||
Mouse   216 YSSFQAMKENNMSNYSLVSEDI------ITNGFKLMRKGTTGDWKNHFTVAQAEAFD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 68/248 (27%)
Sult2a4NP_001095004.1 Sulfotransfer_1 33..277 CDD:279075 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.