DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and St2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster


Alignment Length:297 Identity:93/297 - (31%)
Similarity:152/297 - (51%) Gaps:30/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LADTFQPVLDRVY--------DFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLT 105
            |.|.|  ::.|.|        ...|..||||:|:.|:.|:||.||:.||:.::.|:..|:. ||.
  Fly    30 LPDQF--IIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQ-DLR 91

  Fly   106 HRSPFLEFNGVVPNVPHDTIA--------AANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYR 162
            .|||.:|.:.:.....|:|:|        ....||.||..:||||..:||.|..:.:|:|:|..|
  Fly    92 LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTAR 156

  Fly   163 NPKDAAISYFHHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMK 227
            ||||..:||:|:::.:.|..|....|:..|::|:......|.|:|.||:...:.|:.|..||.|.
  Fly   157 NPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMV 221

  Fly   228 GQLGQVISEVAQFL--ERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRF 290
            ..|..|:...|:||  :..:....:|::..||:|:.||.|.|.|..|......:         :|
  Fly   222 KDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSS---------KF 277

  Fly   291 VRRGVVGSHKDELTADIIREFDLWSDSNLRDFKLNMD 327
            :|.|.:|..::.:..::...||.|::.::|...||.|
  Fly   278 IRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNFD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 84/264 (32%)
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100823at50557
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - P PTHR11783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
109.870

Return to query results.
Submit another query.