DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult1st4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_021333897.1 Gene:sult1st4 / 402915 ZFINID:ZDB-GENE-040426-2054 Length:312 Species:Danio rerio


Alignment Length:301 Identity:93/301 - (30%)
Similarity:144/301 - (47%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ASSKPSV-PVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCG--------TTWMQE 85
            ||.||.: |.:.::|..|  |...|....:.|.:|:.|.||:.|.|.||.|        |||:..
Zfish    10 ASMKPCIRPDMFDFEGVF--LTRFFTDNWENVKNFQARPDDILIATYPKAGYSAIKNPRTTWVSY 72

  Fly    86 LAWLVINECDFETAKSVDLTHRSPFL-----EFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWM 145
            :..|:....| |...|..:..|.|||     ||:.:     ..|..|.|...||||||:|||..:
Zfish    73 ILDLLYFGND-ENQTSQPIVQRVPFLESCFQEFSTI-----SGTEMADNLPTSPRLIKTHLPVQL 131

  Fly   146 LPRQIWSKRPKIIYVYRNPKDAAISYFHHWR-GMVGYQ-GTKSDFMHSFIDGYVNFTPCWPHILD 208
            :|:..|.:..:::||.||.||.|:||||..| .||..: |....::..|:.|...|...:.|:..
Zfish   132 VPKSFWEQNSRVVYVARNAKDNAVSYFHFDRMNMVQPEPGDWDSYLDKFMQGQNVFGSWFDHVSG 196

  Fly   209 FWQ-LRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVK 272
            :|| .|..||:.:..:|.:....|:.::.:..||..|.|.::.:::.:.:.|::|:.|...|||.
Zfish   197 WWQKKRSYPNMLYMFFEDLSEDTGREVNRLCSFLGLSTSVQEKEKITKGVQFDAMKQNTLINHVT 261

  Fly   273 -EFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
             .|...|.:.        |:|:|.||..|...|......||
Zfish   262 IPFLDCKISP--------FMRKGKVGDWKSHFTVAQNERFD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 81/263 (31%)
sult1st4XP_021333897.1 Sulfotransfer_1 46..305 CDD:307022 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593143
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4488
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.