DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult6b1.4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_989324.1 Gene:sult6b1.4 / 394949 XenbaseID:XB-GENE-5735978 Length:305 Species:Xenopus tropicalis


Alignment Length:286 Identity:76/286 - (26%)
Similarity:134/286 - (46%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINE-----CDFETAKSVDLTHRSPF 110
            :||:    .:..||.|:||:.:|:.|||||.|...|    :|:     |:.:.:..:      |.
 Frog    47 ETFK----ALESFEAREDDLMLVSYPKCGTNWSVNL----LNDIVKAVCNKDPSPII------PI 97

  Fly   111 LEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHW 175
            |||..      .|.....|..||||::.:||....:|::.:.|:.|::.|:|||||.|:||||.:
 Frog    98 LEFGA------PDKFEKLNQEPSPRVLATHLHYDNIPQRFFDKKLKMMVVFRNPKDTAVSYFHFY 156

  Fly   176 RG--MVGYQGTKSDFMHSFIDGYVNFTPCWPHILDF---WQLRH--EPNIFFTSYERMKGQLGQV 233
            ..  ::....:...|...|:.|.|    ||....|.   |. :|  :..:...::|.||..|...
 Frog   157 NNNPVLPKYSSWDTFFEDFMSGNV----CWGSYFDHALAWN-KHIDDEGVLIMTFEEMKEDLKAA 216

  Fly   234 ISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGS 298
            :.::::|...|:::||.|::....:|.:|::...... |:|..:            |:|:|.||.
 Frog   217 VKKISKFFGLSLNEEQTQEVAGKGTFTAMKEKMTETR-KDFAKI------------FLRKGEVGD 268

  Fly   299 HKDELTADIIREFDLWSDSNLRDFKL 324
            .|:..:....:|.|...::.|...||
 Frog   269 WKNHFSEAQSQEIDAKFEACLAGTKL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 69/266 (26%)
sult6b1.4NP_989324.1 Sulfotransfer_1 59..292 CDD:366246 69/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.