DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult1a1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_988960.1 Gene:sult1a1 / 394557 XenbaseID:XB-GENE-970475 Length:287 Species:Xenopus tropicalis


Alignment Length:291 Identity:93/291 - (31%)
Similarity:150/291 - (51%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKS 101
            |...|||               .|..|:.|.||:.|.|.||.|||||.|:...::...:.|..|:
 Frog    17 PFAANWE---------------NVEKFQARPDDLLIATYPKSGTTWMSEIVDQIVAVSNSERCKT 66

  Fly   102 VDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKD 166
            ..:..|.||||:  .||::|..| .|.:...||||||:|||..:||:..|..:.|:|||.||.||
 Frog    67 AAIYERVPFLEY--AVPDMPSGT-QALDQRASPRLIKTHLPVELLPKSFWDNKVKVIYVARNAKD 128

  Fly   167 AAISYFHHWRGMVGY--QGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQ 229
            .|:||:|.:|..:.:  .||..:|:.|:|:|.|.|.....|:..:||...|.::.:..||.|...
 Frog   129 VAVSYYHFYRMAIVHPEPGTWDEFLDSYINGKVCFGSWSAHVKGWWQKAKEWDVLYLFYEDMLED 193

  Fly   230 LGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRG 294
            ..:.|.:|.:|:.:.:.:|.::::....||::|:.|...|:     ||..::..:.....|:|:|
 Frog   194 PTREIRKVVKFMGKDLPEETVEKIASQTSFKAMKQNELSNY-----SMVPSSVMDHSISPFMRKG 253

  Fly   295 VVGSHKDELTADIIREFDLWSDSNLRDFKLN 325
            |.|..|::.|.....:||.:....:.|..|:
 Frog   254 VCGDWKNQFTVAQNEKFDEYYQREMSDGALS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 84/256 (33%)
sult1a1NP_988960.1 Sulfotransfer_1 32..280 CDD:395556 84/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.