DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT6B1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001354480.1 Gene:SULT6B1 / 391365 HGNCID:33433 Length:303 Species:Homo sapiens


Alignment Length:259 Identity:75/259 - (28%)
Similarity:119/259 - (45%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFN 114
            ::||| .||   .||.|.||:.:.:.||||:.|:..    :::|..:..:|........|.||..
Human    42 SETFQ-ALD---TFEARHDDIVLASYPKCGSNWILH----IVSELIYAVSKKKYKYPEFPVLECG 98

  Fly   115 GVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGM- 178
                  ..:........||||::.:||....||..|:..:.||:.::|||||.|:|:.|....: 
Human    99 ------DSEKYQRMKGFPSPRILATHLHYDKLPGSIFENKAKILVIFRNPKDTAVSFLHFHNDVP 157

  Fly   179 -VGYQGTKSDFMHSFIDGYVNFTPCWPHILDF---WQLRH--EPNIFFTSYERMKGQLGQVISEV 237
             :...|:..:|...|:.|.|:    |....||   |. :|  ..|:.|..||.:|..|...|.::
Human   158 DIPSYGSWDEFFRQFMKGQVS----WGRYFDFAINWN-KHLDGDNVKFILYEDLKENLAAGIKQI 217

  Fly   238 AQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKD 301
            |:||...::.||:|.:....:|::||......|        .|.|    .|.| |:|.||..|:
Human   218 AEFLGFFLTGEQIQTISVQSTFQAMRAKSQDTH--------GAVG----PFLF-RKGEVGDWKN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 67/242 (28%)
SULT6B1NP_001354480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.