DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and St3

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001261155.1 Gene:St3 / 37743 FlyBaseID:FBgn0265052 Length:526 Species:Drosophila melanogaster


Alignment Length:318 Identity:128/318 - (40%)
Similarity:186/318 - (58%) Gaps:40/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSVPFEQIDKLAISGGYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIV 73
            :|.|...|||   ..|...:|.:..         .:.|.||          |:|.::||||||||
  Fly     9 RSYPTNLIDK---DWGNRKLFYTKD---------SENFLRL----------VHDMKLRDDDVWIV 51

  Fly    74 TLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIK 138
            |||||||||||||.||::|.||||.|.:.|...|:|||||...|.:.|:.:......|.||||||
  Fly    52 TLPKCGTTWMQELLWLLLNNCDFEGALAKDQELRTPFLEFGYSVFHDPNRSFGPIEDLKSPRLIK 116

  Fly   139 SHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGM-VGYQGTKSDFMHSFIDGYV---NF 199
            |||...:||.::|..:.|:|||.|||.|:.:|.::|  |: .|:...||  :|.:.|..:   :|
  Fly   117 SHLSLALLPSKLWEGKNKVIYVSRNPLDSYVSRYYH--GVSFGFNYGKS--LHQYFDEVLASDDF 177

  Fly   200 -TPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMR 263
             |....|..:|:|||:||.:|:||:|.||..|..||::|::||.:.::.:||:::.:||||..|:
  Fly   178 PTEFIEHAHEFYQLRNEPWVFYTSFEMMKKDLRGVINDVSRFLNKPINDQQMEKLLKHLSFAEMK 242

  Fly   264 DNPACNHVKEFESMK-AAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLR 320
            .||..||:.|...:: ..||:|:..  |||||.|..:||||..:.|.:      :|:|
  Fly   243 KNPTTNHLWELAQVQHENAGKEMHP--FVRRGDVNGYKDELKPEQIEK------ANVR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 115/260 (44%)
St3NP_001261155.1 Sulfotransfer_1 45..301 CDD:279075 115/260 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444806
Domainoid 1 1.000 149 1.000 Domainoid score I4409
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4488
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100823at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44260
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
88.000

Return to query results.
Submit another query.