DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and St4

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001286398.1 Gene:St4 / 36548 FlyBaseID:FBgn0033887 Length:346 Species:Drosophila melanogaster


Alignment Length:304 Identity:102/304 - (33%)
Similarity:144/304 - (47%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPH 122
            :|.|:||.|.|||||.|:|:.||||.|||.|||.|..|||.|:...||.|.||.||    |...|
  Fly    53 ERYYNFEARPDDVWIATVPRSGTTWTQELIWLVANGLDFEHAQERPLTERFPFFEF----PLFVH 113

  Fly   123 DTIA---------AANAL-------------------PSPRLIKSHLPAWMLPRQIWSKRPKIIY 159
            ..|.         :|.||                   ...|.||:|.|..::|..:..|:.|:||
  Fly   114 PKIKEELQEENRDSAEALEFIEKIARPGYEALSEIPRSQRRFIKTHFPFSLMPPSVLEKKCKVIY 178

  Fly   160 VYRNPKDAAISYFHHWR--GMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTS 222
            |.|:|||.|:||:|..|  ...||.|....:.|.|.:|...:.|.:.|:.:..:..|..|:.|..
  Fly   179 VVRDPKDVAVSYYHLNRLFRTQGYVGDFERYWHYFQNGLNPWLPYYSHVKEAREHAHLSNVLFLR 243

  Fly   223 YERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESM----KAAAGR 283
            ||.|...|...|:.:|.|||.....|.|.::..|||..|.|:|.:.| :.|..|:    |..|| 
  Fly   244 YEDMLADLPGAINSIASFLECPPKPEDMDRLLDHLSIRSFRENKSVN-MHEMASVGVLNKGEAG- 306

  Fly   284 EVEEFRFVRRGVVGSHKDEL----TADIIREFDLWSDSNLRDFK 323
                  |||.|...:::.:.    ...:::..:.|.:.|::.||
  Fly   307 ------FVRSGAKTAYQPQQEFVENPKLLKSANEWVEQNIKSFK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 95/292 (33%)
St4NP_001286398.1 Sulfotransfer_1 62..311 CDD:279075 92/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - P PTHR11783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
109.800

Return to query results.
Submit another query.