DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2a2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001020302.1 Gene:Sult2a2 / 361510 RGDID:1306542 Length:285 Species:Rattus norvegicus


Alignment Length:253 Identity:66/253 - (26%)
Similarity:124/253 - (49%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAA 127
            |.|::||:.|:|.||.||.|:.|:..|:..:.|.:..:|:.:..|||::|...     .:|.:  
  Rat    30 FVVKEDDLIILTYPKSGTNWLIEIVCLIQTKGDPKWIQSMPIWDRSPWIETGS-----GYDKL-- 87

  Fly   128 ANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKS--DFMH 190
             ..:..|||:.||||..:..:.::|.:.|:||:.|||:|..:|.:..|..:...:...|  .::.
  Rat    88 -TKMEGPRLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSAYFFWSKIALEKKPDSLGTYVE 151

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            .|:.|.|.:...:.||..:..:|...|.....||.||......|.::..||.:.:..:::..:.:
  Rat   152 WFLKGNVAYGSWFEHIRGWLSMREWDNFLVLYYEDMKKDTMGSIKKICDFLGKKLEPDELNLVLK 216

  Fly   256 HLSFESMRDNPACNH-VKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            :.||:.:::|...|: :.|.|.:       :..|.|:|:|.....|:..|......||
  Rat   217 YSSFQVVKENNMSNYSLMEKELI-------LTGFTFMRKGTTNDWKNHFTVAQAEAFD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 64/249 (26%)
Sult2a2NP_001020302.1 Sulfotransfer_1 34..278 CDD:279075 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351380
Domainoid 1 1.000 153 1.000 Domainoid score I4182
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm12324
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.