DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1e1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_037015.2 Gene:Sult1e1 / 360268 RGDID:3776 Length:295 Species:Rattus norvegicus


Alignment Length:277 Identity:82/277 - (29%)
Similarity:140/277 - (50%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLE----- 112
            |....:.|..|..|.||:.:||.||.|:||:.|:..::..|.|.|..|...:.:|.|:||     
  Rat    24 FTKYWEDVETFSARPDDLLVVTYPKSGSTWIGEIVDMIYKEGDVEKCKEDAIFNRIPYLECRNED 88

  Fly   113 -FNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR 176
             .||         |.......|||::|:||||.:||...|.|..||||:.||.||..:||::.:.
  Rat    89 LING---------IKQLKEKESPRIVKTHLPAKLLPASFWEKNCKIIYLCRNAKDVVVSYYYFFL 144

  Fly   177 GMVGYQGTK--SDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQ 239
            .:..|...|  |:|:..|::|.|.:...:.|:..:|:......:.|..||.||..:.:.:.::.:
  Rat   145 IIKSYPNPKSFSEFVEKFMEGQVPYGSWYDHVKSWWEKSKNSRVLFMFYEDMKEDIRREVVKLIE 209

  Fly   240 FLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELT 304
            ||||....|.:.::.:|.||:.|::||..|:     ||......:::...|:|:|:||..::...
  Rat   210 FLERDPLAELVDKIIQHTSFQEMKNNPCTNY-----SMLPETMIDLKVSPFMRKGIVGDWRNHFP 269

  Fly   305 ADIIREFDLWSDSNLRD 321
            ..:...|:.....:::|
  Rat   270 EALRERFEEHYQRHMKD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 78/263 (30%)
Sult1e1NP_037015.2 Sulfotransfer_1 38..288 CDD:307022 78/263 (30%)
Substrate binding. /evidence=ECO:0000250 106..108 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm12324
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.