DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult6b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_999851.2 Gene:sult6b1 / 322462 ZFINID:ZDB-GENE-050417-228 Length:296 Species:Danio rerio


Alignment Length:271 Identity:78/271 - (28%)
Similarity:130/271 - (47%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVP 121
            ||::.|.:.|:||:.:|..||||..||..:...:||.   .|.|......|.|.:||   :|...
Zfish    38 LDKLKDLQAREDDLILVAYPKCGFNWMVAVLRKIINA---STGKDEKPPERPPLVEF---LPPTV 96

  Fly   122 HDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKS 186
            .:.:|   .:|.|||:.:||....:|...::|:|||:.|:|||||..:||:|...........:|
Zfish    97 QEEMA---QMPPPRLLGTHLHPDNMPATFFTKKPKILVVFRNPKDTVVSYYHFMNKNPVLPNAES 158

  Fly   187 --DFMHSFIDGYVNFTPCWPHILDFWQLR-HEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQE 248
              .|...|:.|.|::...:.|.| .|:.| .:||:....||.:|..|.:.:.::::|....::.|
Zfish   159 WDKFFSDFMTGDVSWGSYFDHAL-AWEKRIDDPNVMIVMYEDLKQNLPEGVKKISEFFSLPLTDE 222

  Fly   249 QMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDL 313
            |:..:....:|.:|.:|...:| ..|.|:            |.|:|.||..|:..:....::.|.
Zfish   223 QVSSIAGQSTFSAMVENSQKSH-GNFGSI------------FFRKGEVGDWKNHFSEAQSKQMDE 274

  Fly   314 WSDSNLRDFKL 324
            ...|.|...||
Zfish   275 LYHSKLAGTKL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 72/257 (28%)
sult6b1NP_999851.2 Sulfotransfer_1 48..283 CDD:307022 72/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.