DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult3st2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001073416.1 Gene:sult3st2 / 322415 ZFINID:ZDB-GENE-030131-1135 Length:299 Species:Danio rerio


Alignment Length:290 Identity:89/290 - (30%)
Similarity:145/290 - (50%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTH-RSPFLEFNGVVPNV 120
            :|.:.|||.|||||::||.||.||.|.|.:..|:..| || ..|:.::|: :.|::|:       
Zfish    34 IDSLQDFETRDDDVFVVTFPKSGTVWTQRIMTLIYEE-DF-PEKANEITYEQMPWIEY------- 89

  Fly   121 PHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTK 185
             .:.....||.|||||..|||...::||.: .|:.|:|||.|||||..:||||....|.....::
Zfish    90 -REKGKDYNARPSPRLFCSHLLEPLMPRAL-QKKGKVIYVMRNPKDVMVSYFHFSNKMKNLDSSE 152

  Fly   186 S--DFMHSFIDGYVNFTPC-----W-PHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLE 242
            :  :.:.:|      ||.|     | .|:..:...:.:.||...:||.|...|..||.::.:|:.
Zfish   153 NYDEILENF------FTGCMIGGSWFDHVKGWVTSKDKYNILILTYEEMIKDLRSVIVKICKFVG 211

  Fly   243 RSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFR---FVRRGVVGSHKDELT 304
            :::|...:.::....:|..|:.:|..|    :||:.    :||.:..   |:|:|.||..|:.||
Zfish   212 KNLSDAAINKVVERTTFNQMKVDPVAN----YESLP----QEVTDQPKGVFMRKGTVGDWKNSLT 268

  Fly   305 AD----IIREFD----------LWSDSNLR 320
            ..    :.|.|:          :|..:.||
Zfish   269 VAQSECVDRVFEERMKHVPLNLVWDIAELR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 84/280 (30%)
sult3st2NP_001073416.1 Sulfotransfer_1 44..284 CDD:279075 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593173
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4488
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.