DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034754.1 Gene:Sult2b1 / 292915 RGDID:1308882 Length:375 Species:Rattus norvegicus


Alignment Length:252 Identity:76/252 - (30%)
Similarity:132/252 - (52%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAAN 129
            |||||::|||.||.||.||.|:..|::.:.|....:|..:..|:|:.|          .||:|.:
  Rat    90 VRDDDIFIVTYPKSGTNWMIEIICLILKDGDPSWIRSEPIWQRAPWCE----------TTISAFS 144

  Fly   130 --ALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQ--GTKSDFMH 190
              ..|||||:.||||..:..:..:|.:.|:||:.|||:|..:|.:::.:..|..:  ||...|:.
  Rat   145 LPERPSPRLMCSHLPIELFTKAAFSSKAKVIYLGRNPRDVVVSLYYYSKIAVQLKDPGTPEQFLQ 209

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            :|:.|.|.|...:.||..:.::|...|..|.:||.::..|...:..:.:||.|.:.:|.:..:..
  Rat   210 NFLKGEVQFGSWFDHIKGWIRMRGRENFLFITYEELQQDLRGSVQLICEFLGRPLGEEALSSVVA 274

  Fly   256 HLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            |.:|.:|:.|...|:     ::..|:..:..:..|:|:|:.|..|:..|......||
  Rat   275 HSAFAAMKANNMSNY-----TLLPASLLDHRQGAFLRKGISGDWKNHFTVAQSETFD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 74/250 (30%)
Sult2b1NP_001034754.1 Sulfotransfer_1 92..337 CDD:366246 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351389
Domainoid 1 1.000 153 1.000 Domainoid score I4182
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm12324
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.