DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT1B1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_005265733.1 Gene:SULT1B1 / 27284 HGNCID:17845 Length:301 Species:Homo sapiens


Alignment Length:302 Identity:90/302 - (29%)
Similarity:147/302 - (48%) Gaps:43/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAISGGY--SSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTT 81
            |.:..||  :..|||         |||               ::..|..|.||:.|.|.||.|||
Human    17 LKLVHGYPMTCAFAS---------NWE---------------KIEQFHSRPDDIVIATYPKSGTT 57

  Fly    82 WMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWML 146
            |:.|:..:::|:.|.|..|...:|.:.|.||.  .:|.:....|......||||::|:|||..:|
Human    58 WVSEIIDMILNDGDIEKCKRGFITEKVPMLEM--TLPGLRTSGIEQLEKNPSPRIVKTHLPTDLL 120

  Fly   147 PRQIWSKRPKIIYVYRNPKDAAISYFHH--WRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDF 209
            |:..|....|:||:.||.||.::||:|.  ...:..:.||..:::..|:.|.|.:...:.|:.::
Human   121 PKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNW 185

  Fly   210 WQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNH---- 270
            |:.:.|..|.|..||.||....:.|.::.:|||::::.|.:.::..|.|||.|:|||..|:    
Human   186 WKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLP 250

  Fly   271 VKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFD 312
            ....:..|:.         |:|:|..|..|:..|.....:||
Human   251 TTVMDHSKSP---------FMRKGTAGDWKNYFTVAQNEKFD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/252 (31%)
SULT1B1XP_005265733.1 Sulfotransfer_1 43..293 CDD:279075 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157387
Domainoid 1 1.000 149 1.000 Domainoid score I4409
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69169
Inparanoid 1 1.050 154 1.000 Inparanoid score I4327
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8574
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.