DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT4A1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_055166.1 Gene:SULT4A1 / 25830 HGNCID:14903 Length:284 Species:Homo sapiens


Alignment Length:287 Identity:89/287 - (31%)
Similarity:140/287 - (48%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSVPVVGNWEQRF-----CRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINE 93
            ||.|  |.:|.::     .||....:..::.:.:|.||..||||||.||.||:.:||:.:||...
Human     9 PSTP--GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQG 71

  Fly    94 CDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKII 158
            .|.:....:::..:.|.||:       |...:.....|.||||||||||...||..:.:...|:|
Human    72 ADPDEIGLMNIDEQLPVLEY-------PQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVI 129

  Fly   159 YVYRNPKDAAISYFHHWRGM--VGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFT 221
            |:.|||||..:||:...|.:  :.|:||..:|...|::..:.:...:.|:.:||:.|.:.|:.|.
Human   130 YMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFL 194

  Fly   222 SYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVE 286
            .||.|...|..::.::|:||..|..:.|::.:..|.  ..:.|. .||                .
Human   195 KYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHC--HQLVDQ-CCN----------------A 240

  Fly   287 EFRFVRRGVVGSHKDELTADIIREFDL 313
            |...|.||.||..||..|..:..:|||
Human   241 EALPVGRGRVGLWKDIFTVSMNEKFDL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/249 (32%)
SULT4A1NP_055166.1 Sulfotransfer_1 45..277 CDD:395556 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8574
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.