DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2a6

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_036827.3 Gene:Sult2a6 / 24902 RGDID:3727 Length:284 Species:Rattus norvegicus


Alignment Length:265 Identity:71/265 - (26%)
Similarity:132/265 - (49%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNG 115
            :|.|.|.::   |.|:::|:.::|.||.||.|:.|:..|:..:.|.:..:||.:..|||::|   
  Rat    20 ETLQNVCNK---FVVKEEDLILLTYPKSGTNWLIEIVCLIQTKGDPKWIQSVTIWDRSPWIE--- 78

  Fly   116 VVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHW--RGM 178
              .::.:|.:....   .||||.||||..:..:.::|.:.|:||:.|||:|..:|.::.|  ..:
  Rat    79 --TDLGYDMLIKKK---GPRLITSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSGYYFWGKTTL 138

  Fly   179 VGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLER 243
            .....:...::..|:.|||.:...:.||..:..:|...|.....||.||......|.::..||.:
  Rat   139 AKKPDSLGTYVEWFLKGYVPYGSWFEHIRAWLSMRELDNFLLLYYEDMKKDTMGTIKKICDFLGK 203

  Fly   244 SVSQEQMQQMQRHLSFESMRDNPACNH-VKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADI 307
            .:..:::..:.::.||:.|::|...|: :.|.|.:       :..|.|:|.|..|..|:..|...
  Rat   204 KLEPDELDLVLKYSSFQVMKENNMSNYNLMEKELI-------LPGFTFMRNGTTGDWKNHFTVAQ 261

  Fly   308 IREFD 312
            ...||
  Rat   262 AEAFD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 66/249 (27%)
Sult2a6NP_036827.3 Sulfotransfer_1 33..277 CDD:279075 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4182
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm12324
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.