DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult3a2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001094922.1 Gene:Sult3a2 / 215895 MGIID:3645972 Length:293 Species:Mus musculus


Alignment Length:305 Identity:102/305 - (33%)
Similarity:157/305 - (51%) Gaps:37/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAW 88
            ||:  |..:..|:.:|.|.|                  |:|:||||::|||.||.||||.|::..
Mouse    13 GYN--FLRALVSMDIVKNME------------------DYEIRDDDIFIVTYPKSGTTWTQQILC 57

  Fly    89 LVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSK 153
            |:..|......:::....|.|..|:|      .|....|  .:||||:..||:|.:::|:.:..|
Mouse    58 LICFESHRNGTENIATIDRIPSFEYN------IHKLDYA--KMPSPRIFTSHIPYYLVPKGLKDK 114

  Fly   154 RPKIIYVYRNPKDAAISYFHHWRGMVGYQG--TKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEP 216
            :.|||||||||||..||:||....||..:.  |..:||..|::|.:..:..:.||..:::.||:.
Mouse   115 KAKIIYVYRNPKDVLISFFHFSNLMVVLKASDTLENFMQRFLNGNLVGSLWFDHIRGWYEHRHDF 179

  Fly   217 NIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACN--HVKEFESMKA 279
            ||.|.|:|.||..|...:.::..|||:.:|:|.|..:.|..:||.|:.:|..|  |:     :|.
Mouse   180 NIMFMSFEDMKKDLRSSVLKICSFLEKELSEEDMDAVVRQATFEKMKADPRANNEHI-----IKD 239

  Fly   280 AAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRDFKL 324
            ..|.......|:|:|:||..|..||.|....||.....|:::..|
Mouse   240 ELGTRNNTGAFLRKGIVGDWKHYLTVDQSERFDKIFHMNMKNIPL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 91/258 (35%)
Sult3a2NP_001094922.1 Sulfotransfer_1 36..280 CDD:366246 91/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847771
Domainoid 1 1.000 159 1.000 Domainoid score I4072
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8803
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.