DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1c1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_061221.2 Gene:Sult1c1 / 20888 MGIID:102928 Length:304 Species:Mus musculus


Alignment Length:271 Identity:83/271 - (30%)
Similarity:144/271 - (53%) Gaps:16/271 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPH 122
            |::::|:.:.||:.|.|..|.||||.||:..::.|:.|.:..:..:...|.||:|:  .:|...:
Mouse    37 DKIWNFQAKPDDLLIATYAKAGTTWTQEIVDMIQNDGDVQKCQRANTYDRHPFIEW--TLPPPLN 99

  Fly   123 DTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR--GMVGYQGTK 185
            ..:..||.:||||.:|:|||..|||...|.:..|||||.||.||..:||::..|  .|:...||.
Mouse   100 SGLDLANKMPSPRTLKTHLPVQMLPPSFWKENSKIIYVARNAKDCLVSYYYFSRMNKMLPDPGTL 164

  Fly   186 SDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQM 250
            .:::.:|..|.|.:...:.|:..:|.::.:..|.:..||.||....:.|.::.:|||:.:|:|.:
Mouse   165 GEYIETFKAGKVLWGSWYDHVKGWWDVKDKHRILYLFYEDMKEDPKREIKKIVKFLEKDISEEVL 229

  Fly   251 QQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWS 315
            .::..|.||:.|:.||..|:.....|:     .:.....|:|:|:.|..|:..|.....:||   
Mouse   230 NKIIHHTSFDVMKQNPMANYTTLPSSI-----MDHSISPFMRKGMPGDWKNYFTVAQSEDFD--- 286

  Fly   316 DSNLRDFKLNM 326
                .|::..|
Mouse   287 ----EDYRKKM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/256 (31%)
Sult1c1NP_061221.2 Sulfotransfer_1 46..297 CDD:279075 81/262 (31%)
Substrate binding. /evidence=ECO:0000250 115..117 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.