DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1a1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_598431.2 Gene:Sult1a1 / 20887 MGIID:102896 Length:298 Species:Mus musculus


Alignment Length:286 Identity:90/286 - (31%)
Similarity:145/286 - (50%) Gaps:24/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFE 97
            ||.|||.|      ..|...|...::::.:|....|||.|.|.||.|||||.|:..::......:
Mouse    13 KPLVPVKG------IPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTTWMSEIMDMIYQGGKLD 71

  Fly    98 TAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYR 162
            ......:..|.|||||:  .|.|| ..:......|:||:||:|||..:||:.:..::.|:|||.|
Mouse    72 KCGRAPVYARIPFLEFS--CPGVP-PGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVAR 133

  Fly   163 NPKDAAISYFHHWRGMVGYQ---GTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYE 224
            |.||..:||::.:: |....   ||...|:.:|:||.|::...:.|:.::|:||....:.:..||
Mouse   134 NAKDVVVSYYNFYK-MAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYE 197

  Fly   225 RMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFR 289
            .||....:.|.::.:||.||:.:|.:..:..|.||:.|::||..|:        .....||.:..
Mouse   198 DMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANY--------TTIPTEVMDHT 254

  Fly   290 ---FVRRGVVGSHKDELTADIIREFD 312
               |:|:|.:|..|:..|......||
Mouse   255 ISPFMRKGTIGDWKNTFTVAQSEHFD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 81/252 (32%)
Sult1a1NP_598431.2 Sulfotransfer_1 41..291 CDD:366246 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5797
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.