DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1c2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_598231.4 Gene:Sult1c2 / 171072 RGDID:621064 Length:296 Species:Rattus norvegicus


Alignment Length:293 Identity:89/293 - (30%)
Similarity:147/293 - (50%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKS 101
            |.|.||.|               :..|:.:.||:.|.|.||.||||:||:..::....|.|..:.
  Rat    24 PTVDNWSQ---------------IQTFKAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCQR 73

  Fly   102 VDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKD 166
            ..:.||.||:|:  ..|..| ..:..|||:|:||::::|||..:||...|:...|.:||.||.||
  Rat    74 TIIQHRHPFIEW--ARPPQP-SGVDKANAMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKD 135

  Fly   167 AAISYFHHWR--GMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQ 229
            ..:||:|.:|  .::...||.:::..:||:|.|::...:.|:..:|::|....|.|..||.||..
  Rat   136 CMVSYYHFYRMSQVLPDPGTWNEYFETFINGKVSWGSWFDHVKGWWEIRDRYQILFLFYEDMKRD 200

  Fly   230 LGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRG 294
            ..:.|.:|.||:.:::.:|.:.::.....||.|::||..|   .....|:...:.:..  |:|:|
  Rat   201 PKREIQKVMQFMGKNLDEEVVDKIVLETLFEKMKENPMTN---RSTVPKSVLDQSISP--FMRKG 260

  Fly   295 VVGSHKDELTADIIREFDLWSDSNLRDFKLNMD 327
            .||..|:..|......||       ..:|..||
  Rat   261 TVGDWKNHFTVAQNDRFD-------EIYKQKMD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 80/256 (31%)
Sult1c2NP_598231.4 Sulfotransfer_1 39..288 CDD:395556 83/263 (32%)
Substrate binding. /evidence=ECO:0000250 107..109 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351368
Domainoid 1 1.000 153 1.000 Domainoid score I4182
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4144
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm12324
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.