DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC100498051

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002935042.2 Gene:LOC100498051 / 100498051 -ID:- Length:287 Species:Xenopus tropicalis


Alignment Length:276 Identity:75/276 - (27%)
Similarity:127/276 - (46%) Gaps:24/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIA 126
            :|:|.|.||:.||.||.||.||.||..|:....|....|:|....|.|::|    ||.: ...|.
 Frog    29 EFQVHDCDVFNVTYPKSGTMWMMELLSLIYTNGDPTWCKAVPSWERVPWIE----VPAI-RKVIQ 88

  Fly   127 AANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQ--GTKSDFM 189
            ..|.   |||..:|||.....:.....:.|:||..|:|:||.:|.:|..:..|.::  |:...|:
 Frog    89 KNNC---PRLFTTHLPRSHFCKSFSGSKAKVIYTARDPRDALVSLYHFAKMSVFFEDPGSFPQFL 150

  Fly   190 HSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQ 254
            ..::.|.:.:...:.||..:.::....|....:||.::..|...:..:..||.:.:.:..:..:.
 Frog   151 KKYLSGDLVYGSWFDHIKGWMEMMGNDNFLLNTYEDLQKDLRGSVVRICTFLGKELDERALDSVV 215

  Fly   255 RHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNL 319
            .:.||::|..|...|     .::.:....|..:..|:|:||.|..|:.||....:.||......:
 Frog   216 ENASFKTMSKNSVAN-----VNLLSEEYTEHGKSPFLRKGVSGDWKNHLTVPQSKYFDCIYKEKM 275

  Fly   320 RDFKLNMDDFANYSKF 335
            :||        || ||
 Frog   276 KDF--------NY-KF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 67/256 (26%)
LOC100498051XP_002935042.2 Sulfotransfer_1 36..278 CDD:279075 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.