DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC100497516

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031748831.1 Gene:LOC100497516 / 100497516 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:275 Identity:84/275 - (30%)
Similarity:145/275 - (52%) Gaps:22/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPH 122
            |.:|.|:.|.||:.|.|.||.|||||||:..|::.|.|.:..:......:.||::   :||..|.
 Frog    37 DTIYGFQARGDDILIATYPKAGTTWMQEIVDLILQEGDAQKGRRAPCFIKVPFID---LVPPKPM 98

  Fly   123 DT-IAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGY--QGT 184
            .: :..|..:.|||::|:|||..:||...|.|..|.:||.||.||..:||::..:...|.  .||
 Frog    99 PSGVELAQTMKSPRVLKTHLPINLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQKMNKGLPPPGT 163

  Fly   185 KSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQ 249
            ..::..:|:.|.|.:...:.|::.:.:...:..|.|..||.|.....:.|.:|.:||.:.:|:|.
 Frog   164 WENYFSTFLSGDVPWGSWFDHVIGWGKAMDKHQILFIFYEDMIEDPMREIRKVTKFLGKDLSEEV 228

  Fly   250 MQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTA--DIIREFD 312
            ::.::.|.||::|::||..|:     :...:|..:.....|:|:|.||..::..|.  :||  ||
 Frog   229 LENIKYHTSFQAMKENPMANY-----TALPSAVMDQTISPFMRKGTVGDWRNHFTVAQNII--FD 286

  Fly   313 LWSDSNLRDFKLNMD 327
                   .::|..|:
 Frog   287 -------EEYKKKME 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 78/259 (30%)
LOC100497516XP_031748831.1 Sulfotransfer_1 47..297 CDD:395556 80/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.