DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC100497405

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031748839.1 Gene:LOC100497405 / 100497405 -ID:- Length:296 Species:Xenopus tropicalis


Alignment Length:301 Identity:90/301 - (29%)
Similarity:148/301 - (49%) Gaps:41/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPVVGN----WEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDF 96
            ||::|:    |               |.:|:|:.|.||:.|...||.|||||||:..|::.|.|.
 Frog    18 VPLLGSTCDAW---------------DSIYNFQARGDDILITGFPKSGTTWMQEIVDLILQEGDA 67

  Fly    97 ETAKSVDLTHRSPFLEFNGVVPNVPHDT-IAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYV 160
            :..:......:.|.:|   ::|..|... :..|..:.|||::|:|||..:||...|.|..|.:||
 Frog    68 QKGRRAPTYIKVPCIE---LIPPKPRPIGVELAQTMKSPRVLKTHLPINLLPPSFWEKNVKAVYV 129

  Fly   161 YRNPKDAAIS--YFHHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSY 223
            .||.||..:|  |||....|:.......:|..:|:.|.|.:...:.|::.:|:...:..|.|..|
 Frog   130 ARNAKDCMVSYYYFHKMNKMLPPPRNLENFFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFY 194

  Fly   224 ERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEF 288
            |.|.....:.|.:|.:||.:.:|.|.::.::.|.||::|::||..|    |.::..|. .|....
 Frog   195 EDMIEDPMREIRKVMKFLGKDLSDEVLENIKYHTSFQAMKENPMTN----FSTVPNAV-LEQTIS 254

  Fly   289 RFVRRGVVGSHKDELTA--DIIREFDLWSDSNLRDFKLNMD 327
            .|:|:|.||..::..|.  :||  ||       .::|..|:
 Frog   255 PFIRKGTVGDWRNHFTVAQNII--FD-------EEYKKKME 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 80/259 (31%)
LOC100497405XP_031748839.1 Sulfotransfer_1 39..289 CDD:395556 82/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.