DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and XB986081

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031761967.1 Gene:XB986081 / 100497264 XenbaseID:XB-GENE-986082 Length:238 Species:Xenopus tropicalis


Alignment Length:257 Identity:64/257 - (24%)
Similarity:111/257 - (43%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 MQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLP 147
            |.|:..|:.:..|.....:|.:..|||:.|..|        ....|..|.|||:|.||:|:.:..
 Frog     1 MSEILNLIKHNGDPTMVTTVPMWSRSPWYETVG--------GYEEAEKLTSPRIISSHIPSQIFS 57

  Fly   148 RQIWSKRPKIIYVYRNPKDAAISYFHH------WRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHI 206
            :.....:.|:||..|||||..:|.|:.      ::....:|....|    |..|...:...:.|:
 Frog    58 KSFIKSKAKVIYTMRNPKDVIVSMFYFSKILKIFKEPENFQALLED----FFQGSGLYGSWFDHV 118

  Fly   207 LDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHV 271
            ..:.|:..:.|.|:.:||.::..|...:..:.:||.:.::.|::..:.:|.||:.|::|...|..
 Frog   119 KGWMQMADKENFFYITYEELQQDLRGSVVRICKFLGKELNDEELDSVVKHSSFKVMKENKMSNFT 183

  Fly   272 ----KEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRDFKLNMDDF 329
                ...:..|..         |:|:||.|..|:..|......||......::|  |||..|
 Frog   184 LIPDDVLDKSKGT---------FMRKGVSGDWKNHFTVAQSEHFDKVYQEKMKD--LNMKFF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 59/248 (24%)
XB986081XP_031761967.1 Sulfotransfer_1 1..229 CDD:395556 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.