DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC100360574

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038956741.1 Gene:LOC100360574 / 100360574 RGDID:2321883 Length:277 Species:Rattus norvegicus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:130/266 - (48%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNG 115
            :|||.|.::   |.|:::|:.|:|.||..|.|:.|:..|:..:.|.:..:||.:..|||::|   
  Rat    20 ETFQNVCNK---FVVKEEDLIILTYPKSRTNWLIEIVCLIQTKGDPKWIQSVPIWDRSPWIE--- 78

  Fly   116 VVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVG 180
              ....:|.:.   .:..|:|:.||||..:..:.::|.:.|:||:.|||:|..:|:         
  Rat    79 --TGKGYDQLI---KIEGPQLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSH--------- 129

  Fly   181 YQGTKSDFMHSFID----GYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFL 241
            |...|.|.:.::::    |.|.:..|:.||..:..:|...|.....||.||......|.::..||
  Rat   130 YXVKKPDSLGTYLEWFPKGNVAYGLCFEHIHGWLSMREWDNFLVLYYEDMKKDTMGTIKKICDFL 194

  Fly   242 ERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTAD 306
            .:::..:::..:.::.||:.|::|...|: ...|......|     |..:|:|.:...|:..|..
  Rat   195 GKNLDPDELNLVLKYSSFQFMKENNMSNY-SPMEKELILTG-----FTLMRKGTIEDWKNHFTVA 253

  Fly   307 IIREFD 312
            ..|.||
  Rat   254 QARAFD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 64/250 (26%)
LOC100360574XP_038956741.1 Sulfotransfer_1 33..270 CDD:395556 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.