DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult6b1.6

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001135574.1 Gene:sult6b1.6 / 100216123 XenbaseID:XB-GENE-22063278 Length:301 Species:Xenopus tropicalis


Alignment Length:289 Identity:77/289 - (26%)
Similarity:133/289 - (46%) Gaps:58/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPVLDRVYDFEVRDDDVWIVTLPKCGTTW----MQELAWLVINECDFETAKSVDLTHRS------ 108
            |...|.:..||.|:||:.|...|||||.|    :|::               |...|:.      
 Frog    42 QETFDALNSFETREDDMLIAAYPKCGTNWTIHLLQDM---------------VHAVHKKDPAAVI 91

  Fly   109 PFLEFNG--VVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISY 171
            |.|||.|  ...|:..::        |||::.:||....:|:.:::|:.|.:.|:|||||.|:||
 Frog    92 PVLEFTGENKFENLKEES--------SPRVLATHLNYDGIPKSLFNKQFKTLVVFRNPKDTALSY 148

  Fly   172 FHHWRGMVGYQGTKS--DFMHSFIDGYVNFTPCW----PHILDFWQLRHEPNIFFTSYERMKGQL 230
            ||.:..........|  .|...|:.|.|    ||    .|::::.:...:.||...::|.||..|
 Frog   149 FHFYNNNPALPTYSSWDTFFEDFMAGNV----CWGSYFDHVIEWNKHIDDENIMIVTFEEMKKDL 209

  Fly   231 GQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGV 295
            ...:.::::|...|:::||:|::....:|:||::....:|        .|.|:.:     .|:|.
 Frog   210 EAAVKQISEFFGLSLNEEQIQRIADKGTFKSMKEKSEESH--------GAFGKII-----FRKGE 261

  Fly   296 VGSHKDELTADIIREFDLWSDSNLRDFKL 324
            ||..::..|....:|.|...::.|...||
 Frog   262 VGDWRNTFTEAQNQEMDAKFEACLAGTKL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/272 (26%)
sult6b1.6NP_001135574.1 Sulfotransfer_1 55..288 CDD:366246 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.