DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult6b1l

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001120086.1 Gene:sult6b1l / 100145095 XenbaseID:XB-GENE-22064145 Length:286 Species:Xenopus tropicalis


Alignment Length:274 Identity:75/274 - (27%)
Similarity:130/274 - (47%) Gaps:24/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNV 120
            :|..:.:|:.||||:.:|:.||.||.|:.|:...:.|.   :....|.:|  || :||..|    
 Frog    24 LLRSLNNFQARDDDLLLVSYPKSGTHWLAEILRQLYNT---KAPNKVSIT--SP-IEFGDV---- 78

  Fly   121 PHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTK 185
              ..:....::...|:|.:||...|:|.....::.|.||:.|||||.|:|.||:::........:
 Frog    79 --GKLEELKSIAGRRIIPTHLSYDMIPSDFKDRKCKAIYIIRNPKDTAVSLFHYYKDNPNLPTIE 141

  Fly   186 S--DFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQE 248
            |  .|.:.|::|.|.....:.|||.:.:.|:|.:..|..||.||..|.:.:.:::.||..::|..
 Frog   142 SWHAFYNMFLNGQVVCGSWFEHILGWEEHRNEMSTLFLYYEAMKKDLPKSVRKISSFLGINLSDN 206

  Fly   249 QMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDL 313
            ::.::.:..||..|:.|....:.....::.|....:...|   |:|.||..|...|....|..| 
 Frog   207 EISEICKKTSFGEMKTNVERENSDPNSTVCALTTNKKLIF---RKGTVGDWKQYFTPKQNRLLD- 267

  Fly   314 WSDSNLRDFKLNMD 327
                  .::|..||
 Frog   268 ------EEYKAKMD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 69/256 (27%)
sult6b1lNP_001120086.1 Sulfotransfer_1 35..275 CDD:279075 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.