DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC100145082

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001120074.1 Gene:LOC100145082 / 100145082 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:289 Identity:87/289 - (30%)
Similarity:150/289 - (51%) Gaps:32/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEF 113
            |.|:.....|.:|:|:.|:||:.:.|.||.|||||||:..|::.|.|.|..:......:.||:: 
 Frog    28 LPDSTCDAWDSIYNFQAREDDILVATFPKAGTTWMQEIVDLILQEGDAEKGRRAPCFIKVPFID- 91

  Fly   114 NGVVPNVPHDT-IAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRG 177
              ::|..|..: :..|..:.|||::|:|||..:||...|.|..|.:||.||.||..:||::..:.
 Frog    92 --LIPPKPMPSGVELAQTMKSPRVLKTHLPINLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQKI 154

  Fly   178 MVGY--QGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQF 240
            ..|.  .||..::..:|:.|.|.:...:.|::.:|:...:..|.|..||.|.....:.|.:|.:|
 Frog   155 NKGLPPPGTWENYFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKF 219

  Fly   241 LERSVSQEQMQQMQRHLSFESMRDNPACN-----HVKEFESMKAAAGREVEEFRFVRRGVVGSHK 300
            |.:.:|.|.::.::.|.||::|::||..|     :|...:::..          |:|:|.||..|
 Frog   220 LGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISP----------FMRKGTVGDWK 274

  Fly   301 DELTA--DIIREFDLWSDSNLRDFKLNMD 327
            :..|.  :||  ||       .::|..|:
 Frog   275 NHFTVAQNII--FD-------EEYKKKME 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/264 (30%)
LOC100145082NP_001120074.1 Sulfotransfer_1 46..297 CDD:279075 81/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.