DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde7a

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_112342.1 Gene:Pde7a / 81744 RGDID:68391 Length:482 Species:Rattus norvegicus


Alignment Length:334 Identity:106/334 - (31%)
Similarity:173/334 - (51%) Gaps:39/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTY 775
            :|::..:|:||||..:.:|:.:.|:.|...:|....:....::|....:.:|.:|:..|...|.|
  Rat   147 MLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPY 211

  Fly   776 HNSTHAADVMQATGAFITQ------LTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSN 834
            ||:.|||||.||...::.:      :|..|:|:        :|||||.||:||||.:..||..:|
  Rat   212 HNAVHAADVTQAMHCYLKEPKLANSVTPWDILL--------SLIAAATHDLDHPGVNQPFLIKTN 268

  Fly   835 DALAVLYNDLTVLENHH--AAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFE 897
            ..||.||.:.:||||||  :|:......|     :|.:|..|:.....:.|..:||||:::|..|
  Rat   269 HYLATLYKNTSVLENHHWRSAVGLLRESG-----LFSHLPLESRHEMEAQIGALILATDISRQNE 328

  Fly   898 HLAKFVSVFGGEEPRDHNPQ-----TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEY 957
            :|:.|         |.|..:     .|.....|:.:|.:|.||:.||.|..:...:|:.::.||:
  Rat   329 YLSLF---------RSHLDKGDLHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEF 384

  Fly   958 FMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID---MPQLITYMQINY 1019
            |.|.|.||:.||. |.|:.||.|.||...||||:.|:::.:...|..|.|   ...::.::.:|.
  Rat   385 FHQGDIEKKYHLG-VSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNK 448

  Fly  1020 SQWKKYDEQ 1028
            :.||....|
  Rat   449 ASWKGLQRQ 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 87/256 (34%)
Pde7aNP_112342.1 PDEase_I 211..431 CDD:395177 85/242 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.