DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and pde9aa

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_009302928.1 Gene:pde9aa / 799942 ZFINID:ZDB-GENE-130920-1 Length:509 Species:Danio rerio


Alignment Length:533 Identity:148/533 - (27%)
Similarity:239/533 - (44%) Gaps:113/533 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 RRCS-FDVRSI--ASDGL-RRTSLAKLTS----------LP--LEAPITKII------------- 616
            |.|| .|::.:  .:.|| |.||::.|.|          :|  .|....|::             
Zfish    26 RFCSPCDIKELFCTATGLSRNTSISLLDSTGAMVSIDPTMPNNTERSPYKVVPVTGSQLADKEEL 90

  Fly   617 --NLLSQVQENCS------------ADEARLIDKVLEFLKREGLYSPQMKEIRTD-DPIATDLIG 666
              |:|:||.|..|            .:...:::|.:|.   ||:...::::.|:| ..:..::  
Zfish    91 FQNVLTQVAEQFSRAFKINELKTEVTNRLAMLEKRVEL---EGMKVVEIEKCRSDIKKLREEM-- 150

  Fly   667 ALLTGPSVYSSRRSSNDSIIRTGSSTRTAAIVPA--KMKSNPIIMELLDESLSWDFDIFKLEEIT 729
                     :||  :|.|.:...........||:  |...:...:|.|.:.|   ||:::.|.  
Zfish   151 ---------ASR--NNSSFLEDNKKLTPRRDVPSYPKYHLSQDTVEALKQPL---FDVWQWES-- 199

  Fly   730 DYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFI-- 792
              :.:|.....|:....:....||:....|.||..|..:|| :|.:||..|...|.|...:.|  
Zfish   200 --NEMLSCLEHMYHDLGLVKDFNINPITLKRWLLCIHDNYR-NNPFHNFRHCFCVTQMMYSMIYL 261

  Fly   793 ----TQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAA 853
                .:.|..|:|::        :.||..||:||||.::.:..|:...|||.|||::.|||||.|
Zfish   262 CGLQEKFTQVDILIL--------MTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCA 318

  Fly   854 ITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKF---VSVFGGEEPRDHN 915
            :.|::....| .|||.:.|.|.:|..|...|.:||||:|.||.|.:..|   |..|      |:|
Zfish   319 VAFQIFSQPD-CNIFASFDPEAFKQIRQGTITLILATDMARHGEIMDSFKQKVDSF------DYN 376

  Fly   916 PQTDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRAT 980
               :||....::.:|||..|:||..|||:....|...:.||||||:|.||...|| |.|..||..
Zfish   377 ---NEEHVTCLKMVLIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKAEGLP-VAPFMDREK 437

  Fly   981 CSIPKSQIGFIEYIIQDMMHAWESFIDM-PQLITYM-------QINYSQWKKYDEQGVNTLAEIM 1037
            .:.|.:|||||::::..|   :|:.:.: ||:...|       :..|.:.|:.|:    .:.|:.
Zfish   438 VTKPTAQIGFIKFVLIPM---FETVMKLFPQIEEVMVQPLRESRDKYEELKQIDD----AMNEMQ 495

  Fly  1038 AKQPPVGKMANSK 1050
            .|:.....|...|
Zfish   496 KKKTENVTMGGKK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 91/257 (35%)
pde9aaXP_009302928.1 PDEase_I 242..472 CDD:278654 91/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.