DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and pde9ab

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_700447.5 Gene:pde9ab / 571737 ZFINID:ZDB-GENE-210629-1 Length:518 Species:Danio rerio


Alignment Length:521 Identity:144/521 - (27%)
Similarity:237/521 - (45%) Gaps:102/521 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 RRCS-FDVRSI---ASDGLRRTSLAKLTS----------LPLEAP--ITKII------------- 616
            |.|| .|:|.:   :|:..|.|::..:.|          :|...|  :.|::             
Zfish    28 RHCSPCDIRDLLCSSSNIARNTAVLLIDSEGALISIDPTMPANTPNNLYKVMSHSTNQGEEKEDM 92

  Fly   617 --NLLSQVQENCS------------ADEARLIDKVLEFLKREGLYSPQMKEIRTDDPIATDLIGA 667
              |:||||.|..:            .:...:::|.:|.   |||...::::.:.|   ...|...
Zfish    93 FQNVLSQVAEQFTRAFRISELKTEVTNRLAMLEKRVEL---EGLKVVEIEKCKND---LKKLKDE 151

  Fly   668 LLTGPSVYSSRRSSNDSIIRT--GSSTRTAAIVPAKMKSNPIIMELLDESLSWDFDIFKLE--EI 728
            :.:|    |.|.:.|.....|  |........||...|.. :..|.:|......||::..|  |:
Zfish   152 MTSG----SMRVNCNCKYNFTDDGKKLSPRRDVPNYPKYT-LSQETIDALKKPTFDVWHWEHNEM 211

  Fly   729 TDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFI- 792
            ......:|..:.:.:.|      |::....|.||..|:.:|| .|.:||..|...|.|.....| 
Zfish   212 LSCLEYMYHDLGLVKEF------NMNPITLKRWLLAIQENYR-DNPFHNFRHCFCVSQMMYGMIH 269

  Fly   793 -----TQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHA 852
                 .:||..||.::        :.||..||:||||.::.:..|:...|||.|||::.|||||.
Zfish   270 LCGLQDRLTMTDMCIL--------MTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHC 326

  Fly   853 AITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHNPQ 917
            |:.|:: |...:.|||.|::.|::|..|..||.:||||:|.:|.|.|..|      ::..|:...
Zfish   327 AVAFQI-LSMPECNIFANIEPESFKQIRQAIITLILATDMAKHGEILDSF------KQKVDNFDC 384

  Fly   918 TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCS 982
            |:||....::.:|||..|:||..||.:....|...:.||||||:|.||...|| |.|..||...:
Zfish   385 TNEEHVKSLKMVLIKCCDISNEVRPTEVAEPWVDCLLEEYFMQSDREKSEGLP-VAPFMDRDKVT 448

  Fly   983 IPKSQIGFIEYIIQDMMHAWESFIDM-PQLITYM-------QINYSQWKKYDEQGVNTLAEIMAK 1039
            .|.:|||||::::..|   :|:.:.: ||:...|       :.:|.:.|:.::    .::|...|
Zfish   449 KPTAQIGFIKFVLIPM---FETVMKLFPQIEEIMVQPLRDSRDHYEELKQIED----AMSEAQKK 506

  Fly  1040 Q 1040
            :
Zfish   507 K 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 90/254 (35%)
pde9abXP_700447.5 PDEase_I 251..481 CDD:278654 90/248 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.