DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and 42Sp43

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001016094.1 Gene:42Sp43 / 548848 XenbaseID:XB-GENE-5898342 Length:365 Species:Xenopus tropicalis


Alignment Length:294 Identity:47/294 - (15%)
Similarity:86/294 - (29%) Gaps:114/294 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KAHSLYER--RLPRVPKLHLLVAGKKNPPTEEEEFRTFQRNLMDLKYPTVLPPNPPLKALLVFHK 317
            |:|:||:.  .||    |...|:|.|         |:|::                 |:.|..|.
 Frog    93 KSHTLYKHGDALP----LKCSVSGCK---------RSFRK-----------------KSALRIHL 127

  Fly   318 SD------SICEAITAACQRHQLDVTLVKSKE----------EALDTLQKSYATAQCYHLIIIDA 366
            |:      |:|:  ...|.......|.:|:.:          |...|:..::...|         
 Frog   128 SEHSKESLSVCD--LPGCGWKSTSATELKAHQRRHGGYRCSHEGCQTISPTWTALQ--------- 181

  Fly   367 RSSKNLDAEHIARTIRHTHGHHLTTIIAVCKKSF------------FEKDDVLIALLDAGVNRCV 419
                           .|...|.|....|.|||.|            .:|..:.:.......::..
 Frog   182 ---------------THLEKHPLELQCATCKKPFKKASALRRHKATHDKKPLKLPCPRQDCDKTF 231

  Fly   420 AETTNLAMCSVELKQILHSIIRPHNVMSTQQALYTALHRLKEVVLITDDLLRIQYANRATERLLN 484
            ....||.          |.:.:.|..:.|.:..:...:|   ...:.:.|||....:....:.|.
 Frog   232 NTVFNLT----------HHVRKVHLCLQTHRCYHAGCNR---SFAMRESLLRHLVVHDPERKKLK 283

  Fly   485 MRLDE---------------IISKQLEDIFVSDL 503
            ::|..               ::.:.|.::|...|
 Frog   284 LKLGRRPPKFRGRGARCPTPVVEEDLTNLFSQKL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075 8/60 (13%)
PAS_9 463..539 CDD:290162 8/56 (14%)
PDEase_I 775..1016 CDD:278654
42Sp43NP_001016094.1 C2H2 Zn finger 17..39 CDD:275368
COG5048 <40..160 CDD:227381 21/98 (21%)
C2H2 Zn finger 50..69 CDD:275368
C2H2 Zn finger 77..100 CDD:275368 4/6 (67%)
C2H2 Zn finger 108..130 CDD:275368 9/47 (19%)
C2H2 Zn finger 138..160 CDD:275368 4/23 (17%)
C2H2 Zn finger 193..213 CDD:275368 5/19 (26%)
C2H2 Zn finger 222..245 CDD:275368 3/32 (9%)
C2H2 Zn finger 253..275 CDD:275368 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165172330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.