DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and yipf6

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001015932.1 Gene:yipf6 / 548686 XenbaseID:XB-GENE-1009736 Length:233 Species:Xenopus tropicalis


Alignment Length:82 Identity:21/82 - (25%)
Similarity:35/82 - (42%) Gaps:13/82 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 GLRRTSLAKLTSLPLEAPITKIINLLSQVQENCSADEARLIDKVLEFLKREG------LYSPQMK 652
            ||...|::  ..:|:|..||..:...||..:..:.||. :.|.::..||..|      :|..:..
 Frog    18 GLSNVSIS--GDIPVEGEITVPMASTSQEDDLSTLDEP-VKDTIMRDLKAVGNKFLHVMYPKKST 79

  Fly   653 EIRTDDPIATDLIGALL 669
            .:..|    .||.|.|:
 Frog    80 TLLRD----WDLWGPLV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654
yipf6NP_001015932.1 Yip1 <50..227 CDD:389810 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165172311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.