DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and PDE7A

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001229247.1 Gene:PDE7A / 5150 HGNCID:8791 Length:482 Species:Homo sapiens


Alignment Length:329 Identity:106/329 - (32%)
Similarity:176/329 - (53%) Gaps:39/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTY 775
            :|::..:|:||||..:.:|:.:.|:.|...:|....:....::|....:.:|.:|:..|...|.|
Human   147 MLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPY 211

  Fly   776 HNSTHAADVMQATGAFITQ------LTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSN 834
            ||:.|||||.||...::.:      :|..|:|:        :|||||.||:||||.:..||..:|
Human   212 HNAVHAADVTQAMHCYLKEPKLANSVTPWDILL--------SLIAAATHDLDHPGVNQPFLIKTN 268

  Fly   835 DALAVLYNDLTVLENHH--AAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFE 897
            ..||.||.:.:||||||  :|:......|     :|.:|..|:.:...:.|..:||||:::|..|
Human   269 HYLATLYKNTSVLENHHWRSAVGLLRESG-----LFSHLPLESRQQMETQIGALILATDISRQNE 328

  Fly   898 HLAKFVSVFGGEEPRDHNPQTD---EET--SILMRRMLIKVADVSNPARPMQFCIEWARRIAEEY 957
            :|:.|         |.|..:.|   |:|  ..|:.:|.:|.||:.||.|..:...:|:.::.||:
Human   329 YLSLF---------RSHLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEF 384

  Fly   958 FMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID---MPQLITYMQINY 1019
            |.|.|.||:.||. |.|:.||.|.||...||||:.|:::.:...|..|.:   ...::.::.:|.
Human   385 FHQGDIEKKYHLG-VSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNK 448

  Fly  1020 SQWK 1023
            :.||
Human   449 ASWK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 88/256 (34%)
PDE7ANP_001229247.1 PDEase_I 211..444 CDD:395177 88/255 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.