DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and PDE3B

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001350499.1 Gene:PDE3B / 5140 HGNCID:8779 Length:1190 Species:Homo sapiens


Alignment Length:585 Identity:139/585 - (23%)
Similarity:231/585 - (39%) Gaps:171/585 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 IATLPQPKEAPRGSLHSVRRCSFDVRSIASDGLRR----TSLAKLTS--------------LPLE 609
            :.|:|:.:.:.....|.|             ||||    :||:.:.|              .|:|
Human   563 LLTIPKQRSSSVSLTHHV-------------GLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIE 614

  Fly   610 APITKIINLLSQVQENCSADEARLIDKVLEFLKREGLYSP-----------------------QM 651
            .|                 |.|..::|....|:|....:|                       .:
Human   615 FP-----------------DTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQML 662

  Fly   652 KEIRTDDPIATDLIGALLTGPS-----VYS-------------------SRR--SSNDSIIRTGS 690
            |.:.|.:...||    ..:|.|     ::|                   ||:  ...|..:...:
Human   663 KYVSTSESDGTD----CCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEA 723

  Fly   691 STRTAAIVPAKMKSNPIIME----LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATL 751
            .:.....:..::..:.|::|    |:::..:|:|.||:|.|.........|...|:..|.....|
Human   724 QSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLL 788

  Fly   752 NIDENVCKAWL---AVIEAHYRKSNTYHNSTHAADVMQA--------------------TG---- 789
            .|.:...:.::   ..:|..|| ...|||..||.||:.|                    ||    
Human   789 EIFKIPTQQFMNYFRALENGYR-DIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETD 852

  Fly   790 ----------AFIT--QLTNKDMLV------MDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDA 836
                      |:|:  ..:|.|...      :..:|.....:|||.||.|||||::|||..:|..
Human   853 SDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAP 917

  Fly   837 LAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAK 901
            .||||||.:||||||||..:.|.|...:.|...:||...:|..|..:|:.||||::.:||:.||:
Human   918 QAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAE 982

  Fly   902 FVSVFGGEEPRDHNPQ----TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTD 962
            |     ..:..|.|..    ::|...:|:.::.||:||::.||:.....::|...|..|::.|.|
Human   983 F-----NAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGD 1042

  Fly   963 EEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDMPQLITYMQINYSQWKKYDE 1027
            ||....||| .|..||::..:.|.|..||.:|:..:.:::::...:|          .||.:.:|
Human  1043 EEANLGLPI-SPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLP----------GQWLEAEE 1096

  Fly  1028  1027
            Human  1097  1096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 89/286 (31%)
PDE3BNP_001350499.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Interaction with RAPGEF3. /evidence=ECO:0000269|PubMed:21393242 1..25
DUF1109 136..>282 CDD:310850
PDEase_I 814..1088 CDD:306695 88/279 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.