DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and PDE3A

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_000912.3 Gene:PDE3A / 5139 HGNCID:8778 Length:1141 Species:Homo sapiens


Alignment Length:722 Identity:180/722 - (24%)
Similarity:278/722 - (38%) Gaps:199/722 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 LITDDLL------RIQYANRATERLLNMRLD-EIISKQLEDIFVSDLSTISEQ--CKNIKEFDGI 519
            ||||.|.      .:..:.||...||:.:|. :.|.|..    |:.::::||.  |.:.:|..  
Human   356 LITDLLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPR----VNPVTSLSENYTCSDSEESS-- 414

  Fly   520 LTVRRKSQEGIPMHV-RVVPVACIGSAPTHLIFNFDVPGGQMDFIATL-PQP-----------KE 571
                .|.:..||..: |.:|...:....:.........|     :.|| |.|           :|
Human   415 ----EKDKLAIPKRLRRSLPPGLLRRVSSTWTTTTSATG-----LPTLEPAPVRRDRSTSIKLQE 470

  Fly   572 APRGSLHS----VRRCSFDVRSIASD-------------GLRRTSLAKLTSL------PLE-API 612
            ||..|..|    |.......||..|.             ..|..:|||::.|      ||: .|.
Human   471 APSSSPDSWNNPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPA 535

  Fly   613 TKIINLLSQVQENCSADEARLIDKVLEFLKREGLYSPQMKEIRTDDPIATDLIGALLTGPSV--- 674
            :.:::.:|.||...|||..          .::.|.|   ....|....|.||...:||.|.:   
Human   536 SSLVSKISAVQFPESADTT----------AKQSLGS---HRALTYTQSAPDLSPQILTPPVICSS 587

  Fly   675 ----YSSRRSSNDSIIRTGSSTRT------AAIVPAKMKSN------------------------ 705
                ||....:::.:.|:|.:|||      .|.|.:..::|                        
Human   588 CGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRK 652

  Fly   706 -----------------------PIIMELLDESL----SWDFDIFKLEEITDYHPLLYLGMEMFR 743
                                   |::|:.||..:    :|:|.||.|.|.........|....:|
Human   653 ASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYR 717

  Fly   744 RFD---VFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQ----------- 794
            .|:   :|....|.......:...:|..|| ...|||..||.||:.|.....||           
Human   718 LFEDMGLFEAFKIPIREFMNYFHALEIGYR-DIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIND 781

  Fly   795 --------------------LTNKDMLVMD-----------RMEEATALIAAAAHDVDHPGRSSA 828
                                :.:|...|.|           .:|.....:|||.||.|||||::|
Human   782 HGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNA 846

  Fly   829 FLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMT 893
            ||..::...||||||.:||||||||..:.|.:...:.|...|||...:|..|..:|:.||||::.
Human   847 FLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDLK 911

  Fly   894 RHFEHLAKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYF 958
            :||:.:|||......:...|   .|:|...:|:.:|.||:||::.||:..:..::|...|..|::
Human   912 KHFDFVAKFNGKVNDDVGID---WTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFY 973

  Fly   959 MQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDMPQLITYMQINYSQW- 1022
            .|.|||....||| .|..||:...:...|..||.:|:..:.::::|...||          .:| 
Human   974 EQGDEEASLGLPI-SPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMP----------GKWV 1027

  Fly  1023 KKYDEQG 1029
            :..||.|
Human  1028 EDSDESG 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075 21/84 (25%)
PAS_9 463..539 CDD:290162 21/84 (25%)
PDEase_I 775..1016 CDD:278654 89/282 (32%)
PDE3ANP_000912.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..482 10/50 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..640 10/49 (20%)
PDEase_I 751..1012 CDD:306695 86/264 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1023..1062 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1100..1141
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.